PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009604990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 308aa    MW: 33994.4 Da    PI: 8.3707
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009604990.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.45e-18141195256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tkeq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  XP_009604990.1 141 RKKLRLTKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 195
                     788899***********************************************98 PP

2HD-ZIP_I/II1261.6e-40141231192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kk+rl+keq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E d+e+Lkr++++l+een+rL+ke +eLr +lk
  XP_009604990.1 141 RKKLRLTKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTELDCEYLKRCCEKLTEENRRLQKELQELR-ALK 231
                     69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.01E-18133198IPR009057Homeodomain-like
PROSITE profilePS5007116.86137197IPR001356Homeobox domain
SMARTSM003895.5E-15139201IPR001356Homeobox domain
PfamPF000461.5E-15141195IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-17141195IPR009057Homeodomain-like
CDDcd000861.80E-15141198No hitNo description
PROSITE patternPS000270172195IPR017970Homeobox, conserved site
PfamPF021831.0E-9197231IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.1E-24197240IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MELALSLGGD TQKPFSFLEK STNNSSSHEE LLTGSNKDIR FCMGLGKSNP NIAAEPGLTN  60
GPERMVLDMN RRPIILAEEA EEGTDLSSPN SNSAVSSFQM EFSSIYRSGI SRSLIGKRDH  120
FEAGNTERGV SDEDENNGLA RKKLRLTKEQ SAFLEESFKE HNTLNPKQKL ALAKQLNLRP  180
RQVEVWFQNR RARTKLKQTE LDCEYLKRCC EKLTEENRRL QKELQELRAL KSSQPFYMQL  240
PATTLTMCPS CERVATTAAT AVPTAAAATT TSATATANAA ATNTTLSLAK PNLFPFPPAQ  300
IHPPQAAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1189197RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009604990.10.0PREDICTED: homeobox-leucine zipper protein HOX11-like isoform X3
RefseqXP_016461626.10.0PREDICTED: homeobox-leucine zipper protein HOX11-like isoform X3
SwissprotP466654e-80HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A068URD41e-118A0A068URD4_COFCA; Uncharacterized protein
STRINGPOPTR_0016s05890.13e-98(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.16e-61homeobox from Arabidopsis thaliana